Myogenin Polyclonal antibody

• 

Myogenin Polyclonal Antibody for ELISA

Cat No. 19249-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ELISA

Synonyms

bHLHc3, Myf 4, MYF4, MYOG, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)

---

Published Applications

• WB: See 6 publications below
• IF: See 1 publications below

Product Information

19249-1-AP targets Myogenin in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6414

  Product name: Recombinant human Myogenin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-224 aa of BC053899

  Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

• Full Name: myogenin (myogenic factor 4)
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC053899
• Gene Symbol: Myogenin
• Gene ID (NCBI): 4656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15173
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Sci Rep; Isozygous and selectable marker-free MSTN knockout cloned pigs generated by the combined use of CRISPR/Cas9 and Cre/LoxP.; Authors - Yanzhen Bi
human	WB	Sci Rep; Optogenetic clustering of CNK1 reveals mechanistic insights in RAF and AKT signalling controlling cell fate decisions.; Authors - Adrian Fischer
mouse	WB	PLoS One; A PCR-Based Method to Construct Lentiviral Vector Expressing Double Tough Decoy for miRNA Inhibition.; Authors - Huiling Qiu
mouse	WB	Exp Cell Res; Guanine-rich RNA binding protein GRSF1 inhibits myoblast differentiation through repressing mitochondrial ROS production.; Authors - Wenxin Yin
mouse	WB,IF	Int J Mol Sci; miR-103-3p Regulates the Proliferation and Differentiation of C2C12 Myoblasts by Targeting BTG2; Authors - Yulin He
mouse	WB	Mol Biol (Mosk); [MiR-222-3р Regulates the Proliferation and Differentiation of C2C12 Myoblasts by Targeting BTG2]; Authors - D L Yang