Myogenin Polyclonal antibody

Myogenin Polyclonal Antibody for ELISA
Cat No. 19249-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ELISA

bHLHc3, Myf 4, MYF4, MYOG, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

19249-1-AP targets Myogenin in WB, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6414

Product name: Recombinant human Myogenin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-224 aa of BC053899

Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Predict reactive species
Full Name myogenin (myogenic factor 4)
Calculated Molecular Weight 25 kDa
GenBank Accession NumberBC053899
Gene Symbol Myogenin
Gene ID (NCBI) 4656
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15173
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Publications

SpeciesApplicationTitle
pigWB

Sci Rep

Isozygous and selectable marker-free MSTN knockout cloned pigs generated by the combined use of CRISPR/Cas9 and Cre/LoxP.

Authors - Yanzhen Bi
humanWB

Sci Rep

Optogenetic clustering of CNK1 reveals mechanistic insights in RAF and AKT signalling controlling cell fate decisions.

Authors - Adrian Fischer
mouseWB

PLoS One

A PCR-Based Method to Construct Lentiviral Vector Expressing Double Tough Decoy for miRNA Inhibition.

Authors - Huiling Qiu
mouseWB

Exp Cell Res

Guanine-rich RNA binding protein GRSF1 inhibits myoblast differentiation through repressing mitochondrial ROS production.

Authors - Wenxin Yin
mouseWB,IF

Int J Mol Sci

miR-103-3p Regulates the Proliferation and Differentiation of C2C12 Myoblasts by Targeting BTG2

Authors - Yulin He
mouseWB

Mol Biol (Mosk)

[MiR-222-3р Regulates the Proliferation and Differentiation of C2C12 Myoblasts by Targeting BTG2]

Authors - D L Yang
Loading...
||
New chat Able
正在加载,请稍候...