MYOM2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYOM2 Polyclonal antibody (32262-1-AP)

• 

  WB analysis using 32262-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32262-1-AP (MYOM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 32262-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 32262-1-AP (MYOM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 32262-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 32262-1-AP (MYOM2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MYOM2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32262-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Myomesin-2, Myomesin family member 2, M-protein, 165 kDa titin-associated protein, 165 kDa connectin-associated protein

---

Tested Applications

• Positive WB detected in: rat skeletal muscle tissue, mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

32262-1-AP targets MYOM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35659

  Product name: Recombinant human MYOM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_003970.3

  Sequence: MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEP

• Full Name: myomesin (M-protein) 2, 165kDa
• Calculated Molecular Weight: 165kDa，1465aa
• Observed Molecular Weight: 165 kDa
• GenBank Accession Number: NM_003970.3
• Gene Symbol: MYOM2
• Gene ID (NCBI): 9172
• RRID: AB_3742556
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P54296
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myomesin proteins comprise three family members encoded by MYOM1, MYOM2 and MYOM3, and localize to the M-band of the sarcomere. These three myomesin isoforms correlate with the contractile properties in different fiber types. MYOM1 is expressed in all striated muscles, whereas MYOM2 is expressed in the adult heart and fast fibers, and MYOM3 is expressed only in skeletal muscle intermediate fiber types (PMID:14609030;26792323;15890201).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Neurobiol; Allele-Specific Methylation Links Non-coding Variant of rs2280906 to MYOM2 Regulation in Schizophrenia.; Authors - Qiyang Li
human, rat	IHC	Biogerontology; Myosin light chain kinase 2 and Myomesin 2 are related to the stiffness of vocal fold lamina propria in aging rats and humans.; Authors - Ji-Min Kim