MYOM3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83852-3-RR (same clone as 83852-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83852-3-RR (MYOM3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83852-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 83852-3-RR (same clone as 83852-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 83852-3-RR (MYOM3 antibody) at dilution of 1:0 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83852-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skeletal muscle using 83852-3-RR (same clone as 83852-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using MYOM3 antibody (83852-3-RR, Clone: 240981F9 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83852-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83852-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83852-3-RR against Human MYOM3 were performed. The affinity constant is 0.106 nM.

MYOM3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83852-3-PBS

Clone No.240981F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Myomesin-3, Myomesin family member 3, Myomesin 3, 240981F9

---

Product Information

83852-3-PBS targets MYOM3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11849

  Product name: Recombinant human MYOM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 888-1213 aa of BC067101

  Sequence: SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEEASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG

• Full Name: myomesin family, member 3
• Calculated Molecular Weight: 162 kDa, 136 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: BC067101
• Gene Symbol: MYOM3
• Gene ID (NCBI): 127294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5VTT5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYOM3 (myomesin 3) is a structural component of the M-band in striated muscle and is involved in sarcomere stability and resistance during intense or sustained stretching. MYOM3 can be detected mainly in intermediate-speed fibers of skeletal muscle. Recently high levels of MYOM3 fragments were detected in sera from patients with muscular dystrophy, including Duchenne muscular dystrophy (DMD). MYOM3 fragments may be used as serum biomarkers for DMD and other neuromuscular disorders.