Myozenin 2 Polyclonal antibody

• 

  WB analysis using 11450-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11450-1-AP (Myozenin 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 11450-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11450-1-AP (Myozenin 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 11450-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11450-1-AP (Myozenin 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11450-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11450-1-AP (Myozenin 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11450-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11450-1-AP (Myozenin 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Myozenin 2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11450-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C4orf5, Calsarcin-1, FATZ related protein 2, MYOZ2, Myozenin 2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: human heart tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

11450-1-AP targets Myozenin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2008

  Product name: Recombinant human MYOZ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC017402

  Sequence: MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL

• Full Name: myozenin 2
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC017402
• Gene Symbol: Myozenin 2
• Gene ID (NCBI): 51778
• RRID: AB_2146749
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPC6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYOZ2 gene encodes for the calcineurin-binding protein myozenin-2 (or Calsarcin-1) belonging to myozenin family. Defects in MYOZ2 gene are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16), a hereditary heart disorder characterized by ventricular hypertrophy. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death (PMID: 17347475). Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, and gamma-filamin. Important role in the modulation of calcineurin signaling and myofibrillogenesis of myozenin-2 have been elucidated (PMID: 11114196). Proteintech's Myozenin-2 antibody 11450-1-AP was raised against full-length protein of human origin and is able to detect band of approximate 34 kDa in Western blotting.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; G9a inhibits MEF2C activity to control sarcomere assembly.; Authors - Jin Rong Ow
rat	WB	J Pain Res; Quantitative proteomics analysis to identify biomarkers of chronic myofascial pain and therapeutic targets of dry needling in a rat model of myofascial trigger points.; Authors - Li-Hui Li