Use Able AI chat for product recommendations

MYOZ3 Polyclonal antibody

MYOZ3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23880-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Calsarcin 3, CS 3, CS3, FATZ related protein 3, FRP3, MYOZ3, myozenin 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat skeletal muscle tissue, mouse skeletal muscle tissue
Positive IHC detected inhuman skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23880-1-AP targets MYOZ3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20839

Product name: Recombinant human MYOZ3 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-251 aa of BC074870

Sequence: MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALAPGYAEPLKGVPPEKFNHTAIPKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL

Predict reactive species
Full Name myozenin 3
Calculated Molecular Weight 251 aa, 27 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC074870
Gene Symbol MYOZ3
Gene ID (NCBI) 91977
RRIDAB_2879347
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ8TDC0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for MYOZ3 antibody 23880-1-APDownload protocol
WB protocol for MYOZ3 antibody 23880-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Martina (Verified Customer) (07-03-2023)

IF protocol for fixed cryosection of mouse skeletal muscle: after a quick permeabilization step with Triton 0,3% in PBS, block with BSA 0,5% and GS 10% in PBS for at least 2 hours at room temperature. Then incubate with primary antibody 1:100 in blocking solution overnight at +4°C. The day after, incubate with secondary antibody 1:200 in blocking solution for 2 hours at room temperature. WB protocol for mouse skeletal muscle proteins: block the membrane with 5% milk in TBS-T for at least 2 hours at room temperature; then incubate with primary antibody 1:1000 in 5% milk in TBS-T at +4°C overnight. The day after, incubate with secondary antibody 1:2000 in 5% milk in TBS-T for 2 hours at room temperature. Developing the membrane, you will see double bands between 39 and 28 kDa.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: Murine skeletal muscle
MYOZ3 Antibody Western Blot,Immunofluorescence validation ( dilution) in Murine skeletal muscle (Cat no:23880-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...