MYOZ3 Polyclonal antibody

MYOZ3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 23880-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Calsarcin 3, CS 3, CS3, FATZ related protein 3, FRP3, MYOZ3, myozenin 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat skeletal muscle tissue, mouse skeletal muscle tissue
Positive IHC detected inhuman skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23880-1-AP targets MYOZ3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20839

Product name: Recombinant human MYOZ3 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-251 aa of BC074870

Sequence: MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALAPGYAEPLKGVPPEKFNHTAIPKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL

Predict reactive species
Full Name myozenin 3
Calculated Molecular Weight 251 aa, 27 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC074870
Gene Symbol MYOZ3
Gene ID (NCBI) 91977
RRIDAB_2879347
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ8TDC0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for MYOZ3 antibody 23880-1-APDownload protocol
WB protocol for MYOZ3 antibody 23880-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Martina (Verified Customer) (07-03-2023)

IF protocol for fixed cryosection of mouse skeletal muscle: after a quick permeabilization step with Triton 0,3% in PBS, block with BSA 0,5% and GS 10% in PBS for at least 2 hours at room temperature. Then incubate with primary antibody 1:100 in blocking solution overnight at +4°C. The day after, incubate with secondary antibody 1:200 in blocking solution for 2 hours at room temperature. WB protocol for mouse skeletal muscle proteins: block the membrane with 5% milk in TBS-T for at least 2 hours at room temperature; then incubate with primary antibody 1:1000 in 5% milk in TBS-T at +4°C overnight. The day after, incubate with secondary antibody 1:2000 in 5% milk in TBS-T for 2 hours at room temperature. Developing the membrane, you will see double bands between 39 and 28 kDa.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: Murine skeletal muscle
MYOZ3 Antibody Western Blot,Immunofluorescence validation ( dilution) in Murine skeletal muscle (Cat no:23880-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...