Malectin Polyclonal antibody

• 

  WB analysis using 26655-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26655-1-AP (Malectin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 26655-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 26655-1-AP (Malectin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 26655-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 26655-1-AP (Malectin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

Malectin Polyclonal Antibody for WB, ELISA

Cat No. 26655-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

MLEC, KIAA0152

---

Tested Applications

• Positive WB detected in: mouse colon tissue, human placenta tissue, rat colon tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IF: See 2 publications below

Product Information

26655-1-AP targets Malectin in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24379

  Product name: Recombinant human MLEC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 106-269 aa of BC000371

  Sequence: EETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVFDVRLNGHVVVKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYIMAGTVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNS

• Full Name: malectin
• Calculated Molecular Weight: 292 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000371
• Gene Symbol: Malectin
• Gene ID (NCBI): 9761
• RRID: AB_2880591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14165
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Malectin is a conserved, endoplasmic reticulum (ER)-resident lectin that recognizes high mannose oligosaccharides displaying terminal glucose residues. Like other intracellular lectins involved in glycoprotein quality control, malectin is highly conserved in animals (PMID: 21298103).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Cell Biol; Competition for calnexin binding regulates secretion and turnover of misfolded GPI-anchored proteins; Authors - Amber M Cheatham
human	WB	Exp Cell Res; Blood coagulation factor VIII D1241E polymorphism leads to a weak malectin interaction and reduction of factor VIII posttranslational modification and secretion.; Authors - Ning Jiang ; KD Validated
		Mol Biol Cell; The prolyl isomerase FKBP11 is a secretory translocon accessory factor; Authors - Amanda DiGuilio
human	WB	Biochemistry; Integrated Structural Analysis of N-Glycans and Free Oligosaccharides Allows for a Quantitative Evaluation of ER Stress.; Authors - Naoki Fujitani
mouse	WB,IF	Nat Commun; The mechanisms to dispose of misfolded proteins in the endoplasmic reticulum of adipocytes; Authors - Shuangcheng Alivia Wu
human	WB,IF	Int Immunopharmacol; Identification of TAP1 as a T-cell related therapeutic target in gastric cancer by mediating oxalipliatin-related synergistic enhancement of immunotherapy; Authors - Yupeng Zhao