Marapsin2/PRSS38 Polyclonal antibody

• 

  WB analysis using 25560-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25560-1-AP (Marapsin2/PRSS38 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 25560-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25560-1-AP (MPN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Marapsin2/PRSS38 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25560-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

MPN2, marapsin-2, PRSS38

---

Tested Applications

• Positive WB detected in: HeLa cells, human testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25560-1-AP targets Marapsin2/PRSS38 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22191

  Product name: Recombinant human MPN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-225 aa of BC130400

  Sequence: IYDMYVGLVNLRVDGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEVQLPLILEPWCHLLYGHMSYIM

• Full Name: marapsin 2
• Calculated Molecular Weight: 326 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC130400
• Gene Symbol: MPN2
• Gene ID (NCBI): 339501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1L453
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRSS38, also known as Marapsin-2, belongs to the peptidase S1 family and is expressed specifically in the testis.