Maturin Polyclonal antibody

• 

  WB analysis using 27936-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27936-1-AP (Maturin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27936-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27936-1-AP (Maturin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

Maturin Polyclonal Antibody for WB, ELISA

Cat No. 27936-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, pig, rat

Applications

WB, ELISA

Synonyms

C7orf41, Ells1, Maturin, Protein Ells1, UPF0452 protein C7orf41

---

Tested Applications

• Positive WB detected in: COLO 320 cells, pig brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27936-1-AP targets Maturin in WB, ELISA applications and shows reactivity with Human, mouse, pig, rat samples.

• Tested Reactivity: Human, mouse, pig, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19932

  Product name: Recombinant human C7orf41 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC156839

  Sequence: MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ

• Full Name: chromosome 7 open reading frame 41
• Calculated Molecular Weight: 131 aa, 15 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC156839
• Gene Symbol: Maturin
• Gene ID (NCBI): 222166
• RRID: AB_3086012
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3F0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.