Mouse MCP-1/CCL2 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83157-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 83157-1-PBS against Mouse MCP-1/CCL2 were performed. The affinity constant is 35.7 nM.

MCP-1/CCL2 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83157-1-PBS

Clone No.230483C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Indirect ELISA

Synonyms

Ccl2, MCP1, MCP-1, 230483C2, C-C motif chemokine 2

---

Product Information

83157-1-PBS targets MCP-1/CCL2 in Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0427

  Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-148 aa of NM-011333

  Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

• Full Name: chemokine (C-C motif) ligand 2
• GenBank Accession Number: NM-011333
• Gene Symbol: MCP-1/CCL2
• Gene ID (NCBI): 20296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10148
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.