Mouse Mesothelin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse serum using 85774-4-RR (same clone as 85774-4-PBS)

  mouse serum were subjected to SDS PAGE followed by western blot with 85774-4-RR (Msln antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85774-4-PBS in a different storage buffer formulation.

Mesothelin Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85774-4-PBS

Clone No.243099D4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

Megakaryocyte-potentiating factor, Mes, Mesothelin, cleaved form, Mpf, Msln

---

Product Information

85774-4-PBS targets Mesothelin in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2864

  Product name: Recombinant Mouse Mesothelin protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 298-600 aa of NM_018857.1

  Sequence: DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

• Full Name: mesothelin
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: NM_018857.1
• Gene Symbol: Msln
• Gene ID (NCBI): 56047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61468
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mesothelin (MSLN) is a cell surface glycoprotein that was discovered in 1992 by Kai Chang, Ira Pastan, and Mark Willingham at the National Cancer Institute in Bethesda, MD. It is synthesized as a 69-kDa precursor protein, which is cleaved to form two proteins: a membrane-bound MSLN and a soluble megakaryocyte potentiating factor (MPF). MSLN is overexpressed in various tumor types, including mesothelioma, ovarian cancer, pancreatic adenocarcinoma, gastric cancer, and triple-negative breast cancer (TNBC). However, it is expressed at low levels in normal tissues, primarily on the mesothelial cells lining the pleura, pericardium, and peritoneum. (PMID: 37869242)