Mmp8 Polyclonal antibody

• 

  WB analysis using 33084-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33084-1-AP (Mmp8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse spleen using 33084-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Mmp8 antibody (33084-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Mmp8 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 33084-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

Collagenase 2, EC:3.4.24.34, Matrix metalloproteinase-8, MMP-8, Neutrophil collagenase

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse spleen tissue, rat lung tissue, rat spleen tissue
• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33084-1-AP targets Mmp8 in WB, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3161

  Product name: recombinant mouse Mmp8 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-465 aa of NM_008611.4

  Sequence: FPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS

• Full Name: matrix metallopeptidase 8
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: NM_008611.4
• Gene Symbol: Mmp8
• Gene ID (NCBI): 17394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O70138
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP8(Matrix metalloproteinase-8) an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells(PMID:15367487). Purified human neutrophil MMP-8 with proeMMP-8 at 70-75 KDa and active enzyme at 65 KDa and amniochorion proenzyme and active enzyme at 65 and 50 KDa, respectively(PMID: 28772283, PMID:15042023).