Mmp8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Mmp8 Polyclonal antibody (33084-1-AP)

• 

  WB analysis using 33084-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33084-1-AP (Mmp8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse spleen using 33084-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Mmp8 antibody (33084-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Mmp8 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 33084-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

Collagenase 2, EC:3.4.24.34, Matrix metalloproteinase-8, MMP-8, Neutrophil collagenase

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse spleen tissue, rat lung tissue, rat spleen tissue
• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33084-1-AP targets Mmp8 in WB, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3161

  Product name: Recombinant Mouse MMP8 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-465 aa of NM_008611.4

  Sequence: FPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS

• Full Name: matrix metallopeptidase 8
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: NM_008611.4
• Gene Symbol: Mmp8
• Gene ID (NCBI): 17394
• RRID: AB_3742847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O70138
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Matrix metalloproteinase 8 (MMP-8), also known as collagenase 2 or neutrophil collagenase, belongs to the family of matrix metalloproteinases (MMPs). As an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, MMP8 is expressed by leukocytes and chorionic cytotrophoblast cells (PMID:15367487). MMP-8 has physiological roles in tissue remodeling of the ECM during tissue injury and wound healing. Purified human neutrophil MMP-8 with proeMMP-8 at 70-75 KDa and active enzyme at 65 KDa and amniochorion proenzyme and active enzyme at 65 and 50 KDa, respectively(PMID: 28772283, PMID:15042023).