Myogenin Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP02266-1

  Sandwich ELISA standard curve of MP02266-1, Human Myogenin Recombinant Matched Antibody Pair - PBS only. 86192-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag25081. 86192-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP02266-1

  The mean Myogenin concentration was determined to be 15.4 ng/mL in C2C12 cell extract based on a 1.4 mg/mL extract load and 8.0 ng/mL in mouse skeletal muscle tissue extract based on a 1.7 mg/mL extract load.

Myogenin Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 86192-1-PBS

Clone No.250187E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

MYOG, bHLHc3, Class C basic helix-loop-helix protein 3, Myf 4, MYF4

---

Product Information

86192-1-PBS targets Myogenin as part of a matched antibody pair:

MP02266-1: 86192-2-PBS capture and 86192-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25081

  Product name: Recombinant human Myogenin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-224 aa of BC053899

  Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

• Full Name: myogenin (myogenic factor 4)
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC053899
• Gene Symbol: Myogenin
• Gene ID (NCBI): 4656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15173
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.