Myopodin Polyclonal antibody

• 

  WB analysis using 25453-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25453-1-AP (Myopodin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

Myopodin Polyclonal Antibody for WB, ELISA

Cat No. 25453-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Genethonin 2, Myopodin, synaptopodin 2, SYNPO2

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

25453-1-AP targets Myopodin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22176

  Product name: Recombinant human SYNPO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-350 aa of BC150629

  Sequence: GYVESTTLQIRPATKTQCTEFFLAPVKTEVPLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKGASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHK

• Full Name: synaptopodin 2
• Calculated Molecular Weight: 1093 aa, 118 kDa
• Observed Molecular Weight: 100~118 kDa
• GenBank Accession Number: BC150629
• Gene Symbol: SYNPO2
• Gene ID (NCBI): 171024
• RRID: AB_2880087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMS6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Biochem; Pharmacological inhibition of BAG3-HSP70 with the proposed cancer therapeutic JG-98 is toxic for cardiomyocytes.; Authors - Thomas G Martin
human	WB,IHC	Oncol Rep; SYNPO2 promotes the development of BLCA by upregulating the infiltration of resting mast cells and increasing the resistance to immunotherapy; Authors - Gongjie Ye
human	WB	J Am Heart Assoc; Dysregulated Autophagy and Sarcomere Dysfunction in Patients With Heart Failure With Co-Occurrence of P63A and P380S BAG3 Variants; Authors - Thomas G Martin
rat	WB	Cell Death Dis; Bone marrow mesenchymal stem cells alleviate neurological dysfunction by reducing autophagy damage via downregulation of SYNPO2 in neonatal hypoxic-ischemic encephalopathy rats; Authors - Lu- Lu Xue
mouse	WB,IF	J Adv Res; Cytoskeletal-related genes function as checkpoints for the maintenance of VSMC contractile phenotype and prevent pathological remodeling in arterial diseases; Authors - Yunchang Liu 刘运畅