GLYR1 Polyclonal antibody

• 

  WB analysis using 14833-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14833-1-AP (GLYR1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14833-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14833-1-AP (GLYR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14833-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14833-1-AP (GLYR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 14833-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14833-1-AP (GLYR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 14833-1-AP

  IP result of anti-GLYR1 (IP:14833-1-AP, 4ug; Detection:14833-1-AP 1:500) with K-562 cells lysate 3200ug.

• 

  IHC staining of mouse testis using 14833-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14833-1-AP (GLYR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 14833-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14833-1-AP (GLYR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14833-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14833-1-AP (GLYR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14833-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14833-1-AP (GLYR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14833-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 14833-1-AP (GLYR1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 14833-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 14833-1-AP (GLYR1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 14833-1-AP

  Immunofluorescent analysis of Hela cells, using N-PAC antibody 14833-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• Featured Product
• KD/KO Validated

GLYR1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14833-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

3-hydroxyisobutyrate dehydrogenase-like protein, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, HIBDL, hNDF

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: mouse testis tissue, human liver cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below
• ChIP: See 1 publications below

Product Information

14833-1-AP targets GLYR1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6637

  Product name: Recombinant human N-PAC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-484 aa of BC064940

  Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH

• Full Name: cytokine-like nuclear factor n-pac
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC064940
• Gene Symbol: N-PAC
• Gene ID (NCBI): 84656
• RRID: AB_10859775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q49A26
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Cell; Transcription factor protein interactomes reveal genetic determinants in heart disease.; Authors - Barbara Gonzalez-Teran
mouse	WB,ChIP	Genomics Proteomics Bioinformatics; Npac Is a Co-factor of Histone H3K36me3 and Regulates Transcriptional Elongation in Mouse Embryonic Stem Cells.; Authors - Sue Yu
human	WB,IHC,IF,CoIP	J Exp Clin Cancer Res; Downregulation of GLYR1 contributes to microsatellite instability colorectal cancer by targeting p21 via the p38MAPK and PI3K/AKT pathways.; Authors - Zhiyan Hu ; KD Validated
mouse	WB	Int J Mol Sci; Npac Regulates Pre-mRNA Splicing in Mouse Embryonic Stem Cells; Authors - Yiwei Qian ; KO Validated