N-PAC Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP02739-1

  The mean GLYR1 concentration was determined to be 8.2 ng/mL in HL-60 cell extract based on a 1.2 mg/mL extract load, 9.4 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02739-1

  Cytometric bead array standard curve of MP02739-1, GLYR1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86877-2-PBS. Detection antibody: 86877-1-PBS. Standard: Ag6637. Range: 0.781-100 ng/mL.

N-PAC Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 86877-2-PBS

Clone No.251890G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

GLYR1, 3-hydroxyisobutyrate dehydrogenase-like protein, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, HIBDL

---

Product Information

86877-2-PBS targets N-PAC as part of a matched antibody pair:

MP02739-1: 86877-2-PBS capture and 86877-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6637

  Product name: Recombinant human N-PAC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-484 aa of BC064940

  Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH

• Full Name: cytokine-like nuclear factor n-pac
• Calculated Molecular Weight: 61 kDa
• GenBank Accession Number: BC064940
• Gene Symbol: N-PAC
• Gene ID (NCBI): 84656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q49A26
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.