N4BP2L2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• N4BP2L2 Polyclonal antibody, PBS Only (17159-1-PBS)

• 

  WB analysis using 17159-1-AP (same clone as 17159-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17159-1-AP (N4BP2L2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17159-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17159-1-AP (same clone as 17159-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17159-1-AP (N4BP2L2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17159-1-PBS in a different storage buffer formulation.

N4BP2L2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17159-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17159-1-PBS targets N4BP2L2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10448

  Product name: Recombinant human N4BP2L2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 234-583 aa of BC010643

  Sequence: DYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRYVSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNIQAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMSISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH

• Full Name: NEDD4 binding protein 2-like 2
• Calculated Molecular Weight: 583 aa, 67 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC010643
• Gene Symbol: N4BP2L2
• Gene ID (NCBI): 10443
• RRID: AB_3669263
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92802
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.