NAB2 Polyclonal antibody

• 

NAB2 Polyclonal Antibody for ELISA

Cat No. 14617-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

EGR 1 binding protein 2, MADER, NAB2, NGFI A binding protein 2, Protein MADER

---

Product Information

14617-1-AP targets NAB2 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6221

  Product name: Recombinant human NAB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-320 aa of BC065931

  Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHEL

• Full Name: NGFI-A binding protein 2 (EGR1 binding protein 2)
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC065931
• Gene Symbol: NAB2
• Gene ID (NCBI): 4665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15742
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.