NAB2 Polyclonal antibody

• 

  WB analysis of human heart using 19601-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 19601-1-AP (NAB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 19601-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 19601-1-AP (NAB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 19601-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 19601-1-AP (NAB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 19601-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 19601-1-AP (NAB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 19601-1-AP

  IP result of anti-NAB2 (IP:19601-1-AP, 4ug; Detection:19601-1-AP 1:700) with K-562 cells lysate 3200ug.

• 

  IHC staining of human brain using 19601-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 19601-1-AP (NAB2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 19601-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 19601-1-AP (NAB2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 19601-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 19601-1-AP (NAB2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 19601-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 19601-1-AP (NAB2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of MCF-7 using 19601-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NAB2 antibody (19601-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1) (red).

NAB2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 19601-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Protein MADER, NGFI-A-binding protein 2, Nab 2, Melanoma-associated delayed early response protein, MADER

---

Tested Applications

• Positive WB detected in: human heart tissue, human brain tissue, K-562 cells, mouse thymus tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human brain tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

19601-1-AP targets NAB2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6346

  Product name: Recombinant human NAB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC065931

  Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHEL

• Full Name: NGFI-A binding protein 2 (EGR1 binding protein 2)
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC065931
• Gene Symbol: NAB2
• Gene ID (NCBI): 4665
• RRID: AB_10640524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15742
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Invest Ophthalmol Vis Sci; β1-Integrin Deletion From the Lens Activates Cellular Stress Responses Leading to Apoptosis and Fibrosis.; Authors - Yichen Wang
mouse	WB	Lab Anim (NY); Early growth response 2 in the mPFC regulates mouse social and cooperative behaviors; Authors - Yanli Zhang