NAC1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85380-2-RR (same clone as 85380-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85380-2-RR (NAC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85380-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85380-2-RR (same clone as 85380-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85380-2-RR (NAC1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85380-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85380-2-RR (same clone as 85380-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85380-2-RR (NAC1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85380-2-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 85380-2-RR (same clone as 85380-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NAC1 antibody (85380-2-RR, Clone: 242788E11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85380-2-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 85380-2-RR (same clone as 85380-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using NAC1 antibody (85380-2-RR, Clone: 242788E11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85380-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 85380-2-RR (same clone as 85380-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug NAC1 Recombinant antibody (85380-2-RR, Clone:242788E11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 85380-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85380-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85380-2-RR against Human NAC1 were performed. The affinity constant is 1.39 nM.

NAC1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85380-2-PBS

Clone No.242788E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

NACC1, 242788E11, BEND8, BTB/POZ domain-containing protein 14B, BTBD14B

---

Product Information

85380-2-PBS targets NAC1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6096

  Product name: Recombinant human NACC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 173-527 aa of BC055396

  Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ

• Full Name: nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC055396
• Gene Symbol: NACC1
• Gene ID (NCBI): 112939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RE7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NAC1, also named as BTBD14B and NACC1, belongs to the BTB/POZ family. NACC1 is a transcriptional repressor, which is amplified and overexpressed in various human cancers and plays critical roles in tumor development, progression, and drug resistance (PMID: 31101655). While NAC1 has been shown to repress the transcription of two tumor suppressors, Gadd45-g and Gadd45-g- interacting protein 1, scientists have found that NACC1 also plays an important role in nontranscriptional function, for example, it can act as a bridge for MAVS and TBK1 in RLR-mediated signaling (PMID: 31235549). The observed molecular weight is consistent with what has been described in the literature (PMID: 37533751).