NADK Polyclonal antibody

• 

  WB analysis of HEK-293 using 29290-1-AP

  WB result of NADK antibody (29290-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-NADK transfected HEK-293 cells.

• 

  WB analysis using 29290-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29290-1-AP (NADK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 29290-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29290-1-AP (NADK antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 29290-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29290-1-AP (NADK antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NADK Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29290-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:2.7.1.23, NAD kinase, Poly(P)/ATP NAD kinase

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Hela cells, Neuro-2a cells, NIH/3T3 cells, rat kidney tissue
• Positive IHC detected in: human ovary cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29290-1-AP targets NADK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30982

  Product name: Recombinant human NADK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-446 aa of BC001709

  Sequence: SRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHFEEEEEEEEEG

• Full Name: NAD kinase
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC001709
• Gene Symbol: NADK
• Gene ID (NCBI): 65220
• RRID: AB_2918272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95544
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAD kinase (NADK) is the sole NADP+-biosynthetic enzyme that catalyzes phosphorylation of NAD+ to yield NADP+ using ATP as a phosphoryl donor, and thus, plays a vital role in the cell and represents a potentially powerful antimicrobial drug target (PMID:21526340). It belongs to the NAD kinase family. NADK has 3 isoforms with the molecular mass of 49, 63 and 46 kDa. The catalytically active human NADK is a homotetramer (PMID:11594753).