NAGK Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86506-1-RR (same clone as 86506-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86506-1-RR (NAGK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86506-1-PBS in a different storage buffer formulation.

NAGK Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86506-1-PBS

Clone No.251285C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.1.-, EC:2.7.1.59, EC:2.7.1.60, GlcNAc kinase, GNK

---

Product Information

86506-1-PBS targets NAGK in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7034

  Product name: Recombinant human NAGK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-344 aa of BC001029

  Sequence: MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS

• Full Name: N-acetylglucosamine kinase
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001029
• Gene Symbol: NAGK
• Gene ID (NCBI): 55577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UJ70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NAGK, also called N-acetylglucosamine kinase, or GlcNAc kinase, converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. NAGK can suppress the formation of α-syn A53T aggregates in neuronal and non-neuronal cells and suggest aggregation suppression is a general function of NAGK (PMID: 32796833). NAGK is broadly expressed in immune cells and has previously been described to contribute to the hexosamine biosynthetic salvage pathway (PMID: 36002575).