NAGLU Polyclonal antibody

• 

NAGLU Polyclonal Antibody for ELISA

Cat No. 16753-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Alpha N acetylglucosaminidase, MPS IIIB, MPS3B, N acetyl alpha glucosaminidase, N acetylglucosaminidase, alpha, NAG, NAGLU, UFHSD, UFHSD1

---

Product Information

16753-1-AP targets NAGLU in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10228

  Product name: Recombinant human NAGLU protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 394-743 aa of BC053991

  Sequence: TASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGSW

• Full Name: N-acetylglucosaminidase, alpha-
• Calculated Molecular Weight: 743 aa, 82 kDa
• GenBank Accession Number: BC053991
• Gene Symbol: NAGLU
• Gene ID (NCBI): 4669
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54802
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.