NAGS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82963-1-RR (same clone as 82963-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82963-1-RR (NAGS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82963-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82963-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82963-1-RR against Human NAGS were performed. The affinity constant is below 1 pM.

NAGS Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82963-1-PBS

Clone No.230279D3

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

N-acetylglutamate synthase conserved domain form, EC:2.3.1.1, ARGA, Amino-acid acetyltransferase, AGAS

---

Product Information

82963-1-PBS targets NAGS in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16073

  Product name: Recombinant human NAGS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-368 aa of BC111713

  Sequence: MDMKPLVVLGLPAPTAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVSVETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLRDSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTELFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYVSEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS

• Full Name: N-acetylglutamate synthase
• Calculated Molecular Weight: 534 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC111713
• Gene Symbol: NAGS
• Gene ID (NCBI): 162417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N159
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

N-acetylglutamate synthase, also known as NAGS, is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAGS is the key enzyme for regulating the hepatic urea cycle and is also highly expressed in the kidney and gut. Deficiency of NAGS leads to hyperammonemia due to decreased activity of CPSI deprived of its cofactor NAG(PMID:12459178,12754705).