NANP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NANP Polyclonal antibody, PBS Only (12519-1-PBS)

• 

  WB analysis using 12519-1-AP (same clone as 12519-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12519-1-AP (NANP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 12519-1-AP (same clone as 12519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12519-1-AP (NANP antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12519-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 12519-1-AP (same clone as 12519-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using NANP antibody (12519-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12519-1-PBS in a different storage buffer formulation.

NANP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12519-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Neu5Ac-9-Pase, N-acylneuraminate-9-phosphatase, HDHD4, Haloacid dehalogenase-like hydrolase domain-containing protein 4, EC:3.1.3.29

---

Product Information

12519-1-PBS targets NANP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3212

  Product name: Recombinant human NANP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-248 aa of BC022552

  Sequence: MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST

• Full Name: N-acetylneuraminic acid phosphatase
• Calculated Molecular Weight: 248 aa, 28 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC022552
• Gene Symbol: NANP
• Gene ID (NCBI): 140838
• RRID: AB_3085396
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBE9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NANP, also known as HDHD4, C20orf147, is a member of the haloacid dehalogenase family of proteins. NANP enables N-acylneuraminate-9-phosphatase activity and is involved in N-acetylneuraminate biosynthetic process.