NANS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NANS Polyclonal antibody (15163-1-AP)

NANS Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15163-1-AP Copied!

Publications (3)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

N-acetylneuraminic acid phosphate synthase, N-acetylneuraminate-9-phosphate synthase, N-acetylneuraminate synthase, N acetylneuraminate synthase, EC:2.5.1.57

• 

  WB analysis of HeLa using 15163-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15163-1-AP (NANS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 15163-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15163-1-AP (NANS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15163-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15163-1-AP (NANS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 15163-1-AP

  IP result of anti-NANS (IP:15163-1-AP, 4ug; Detection:15163-1-AP 1:500) with HepG2 cells lysate 3300 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15163-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15163-1-AP (NANS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15163-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15163-1-AP (NANS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NANS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, human brain tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15163-1-AP targets NANS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7271

  Product name: Recombinant human NANS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-359 aa of BC000008

  Sequence: MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

• Full Name: N-acetylneuraminic acid synthase
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC000008
• Gene Symbol: NANS
• Gene ID (NCBI): 54187
• RRID: AB_2150690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The sialic acids are a family of 9-carbon 2-keto-3-deoxy sugars. They are frequently the terminal sugars on secreted and cell surface glycoproteins and glycolipids. Sialic acids participate in many important biologic recognition events. NANS can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.

Publications

What published studies show

The NANS Polyclonal antibody (Cat# 15163-1-AP) has 3 total citations. These appear in Cell Mol Gastroenterol Hepatol, Front Immunol, and Exp Cell Res. The associated research fields include c-Myc-driven hepatocellular carcinoma metabolism, ferroptosis in thyroid-associated orbitopathy, and macrophage subsets related to immunotherapy response in endometrial cancer.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IHC	Cell Mol Gastroenterol Hepatol; The Role of the Hexosamine-Sialic Acid Metabolic Pathway Mediated by GFPT1/NANS in c-Myc-Driven Hepatocellular Carcinoma; Authors - Shiguan Wang
Human		Front Immunol; Identification and verification of the optimal feature genes of ferroptosis in thyroid-associated orbitopathy; Authors - Xuemei Li
human	IHC	Exp Cell Res; Reanalysis of single-cell data reveals macrophage subsets associated with the immunotherapy response and prognosis of patients with endometrial cancer; Authors - Qianhua Wu

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The product has one review rated 5 out of 5. The reviewer used it for Western Blot on lung fibroblast cells and included a representative image showing clear, specific band detection. No written comments were provided, but the top rating and attached blot image indicate strong performance and satisfaction with the antibody's specificity and signal quality in this application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

PK (Verified Customer) (03-22-2022)

• Applications: Western Blot
• Cell Tissue Type: LUNG Fibroblast

NANS Antibody Western Blot validation ( dilution) in LUNG Fibroblast (Cat no:15163-1-AP)