NANS Polyclonal antibody

• 

  WB analysis of HeLa using 15163-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15163-1-AP (NANS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15163-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15163-1-AP (NANS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15163-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15163-1-AP (NANS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 15163-1-AP

  IP result of anti-NANS (IP:15163-1-AP, 4ug; Detection:15163-1-AP 1:500) with HepG2 cells lysate 3300 ug.

• 

  IHC staining of human stomach cancer using 15163-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15163-1-AP (NANS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 15163-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15163-1-AP (NANS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NANS Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15163-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

N-acetylneuraminic acid phosphate synthase, N-acetylneuraminate-9-phosphate synthase, N-acetylneuraminate synthase, N acetylneuraminate synthase, EC:2.5.1.57

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, human brain tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below

Product Information

15163-1-AP targets NANS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7271

  Product name: Recombinant human NANS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-359 aa of BC000008

  Sequence: MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

• Full Name: N-acetylneuraminic acid synthase
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC000008
• Gene Symbol: NANS
• Gene ID (NCBI): 54187
• RRID: AB_2150690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The sialic acids are a family of 9-carbon 2-keto-3-deoxy sugars. They are frequently the terminal sugars on secreted and cell surface glycoproteins and glycolipids. Sialic acids participate in many important biologic recognition events. NANS can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IHC	Cell Mol Gastroenterol Hepatol; The Role of the Hexosamine-Sialic Acid Metabolic Pathway Mediated by GFPT1/NANS in c-Myc-Driven Hepatocellular Carcinoma; Authors - Shiguan Wang
human	IHC	Exp Cell Res; Reanalysis of single-cell data reveals macrophage subsets associated with the immunotherapy response and prognosis of patients with endometrial cancer; Authors - Qianhua Wu
Human		Front Immunol; Identification and verification of the optimal feature genes of ferroptosis in thyroid-associated orbitopathy; Authors - Xuemei Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

PK (Verified Customer) (03-22-2022)

• Applications: Western Blot
• Cell Tissue Type: LUNG Fibroblast

NANS Antibody Western Blot validation ( dilution) in LUNG Fibroblast (Cat no:15163-1-AP)