Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NARS2 Polyclonal antibody

NARS2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

AsnRS, Asparagine  tRNA ligase, Asparagine--tRNA ligase, mitochondrial, Asparaginyl-tRNA synthetase, EC:6.1.1.22

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for NARS2 in ?

Tested Applications

Positive WB detected inHepG2 cells, human liver tissue, human brain tissue, K-562 cells, mouse kidney tissue
Positive IHC detected inhuman kidney tissue, human heart tissue, human lung tissue, human placenta tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15714-1-AP targets NARS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8345

Product name: Recombinant human NARS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 132-477 aa of BC007800

Sequence: ERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL

Predict reactive species
Full Name asparaginyl-tRNA synthetase 2, mitochondrial (putative)
Calculated Molecular Weight 477 aa, 54 kDa
Observed Molecular Weight 50-54 kDa
GenBank Accession NumberBC007800
Gene Symbol NARS2
Gene ID (NCBI) 79731
RRIDAB_2151157
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96I59
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial) is a nuclear-encoded enzyme that functions within the mitochondria, the energy-producing organelles of the cell. It belongs to the class II family of aminoacyl-tRNA synthetases (aaRSs), a group of essential enzymes responsible for protein synthesis. Its proper function is indispensable for mitochondrial protein synthesis and energy production, and its deficiency underlies a spectrum of severe human metabolic and neurological diseases.

Protocols

Product Specific Protocols
IF protocol for NARS2 antibody 15714-1-APDownload protocol
IHC protocol for NARS2 antibody 15714-1-APDownload protocol
WB protocol for NARS2 antibody 15714-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The NARS2 Polyclonal antibody (Cat# 15714-1-AP) has 2 total citations. These appear in Cell Reports (2025) and EMBO Molecular Medicine (2026). The research fields covered include mitochondrial membrane potential regulation in leukemic cells and comprehensive functional testing in fibroblasts for diagnosing mitochondrial disease.

SpeciesApplicationTitle
human, mouseWB

Cell Rep

A generalized strategy to kill leukemic cells by targeting the regulatory systems governing mitochondrial membrane potential.

Authors - Ting Liu
  • KD Validated

EMBO Mol Med

Comprehensive functional testing in fibroblasts has strong utility to diagnose mitochondrial disease.

Authors - Johan L K Van Hove

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Vera S.) tested this antibody by Western Blot on fibroblasts at a 1:1000 dilution and rated it 3 out of 5. They reported that binding was quite low at that dilution, though the antibody did work. They also noted some unspecific binding to the ladder. Overall, the feedback suggests the antibody is functional but may benefit from optimization of dilution to improve signal strength and reduce background.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vera (Verified Customer) (07-14-2026)

Antibody shows quite low binding at a dilution of 1:1000, but it does work. Antibody also shows some unspecific binding to the ladder.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: fibroblast
Loading...
||
New chat

Able™

正在加载,请稍候...