Product Information
86476-1-PBS targets NAS1/SLC13A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19026 Product name: Recombinant human SLC13A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 143-249 aa of BC148686 Sequence: TAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSST Predict reactive species |
| Full Name | solute carrier family 13 (sodium/sulfate symporters), member 1 |
| Calculated Molecular Weight | 595 aa, 66 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC148686 |
| Gene Symbol | NAS1 |
| Gene ID (NCBI) | 6561 |
| RRID | AB_3744913 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BZW2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC13A1 also known as NAS1, is an apical membrane Na(+)-sulfate cotransporter involved in sulfate homeostasis in the kidney. SLC13A1 primarily participates in pH-independent, sodium-dependent cotransport of sulfate across renal proximal tubules and small intestinal epithelia(PMID: 38552027).

