NAS1/SLC13A1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86476-1-RR (same clone as 86476-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86476-1-RR (NAS1/SLC13A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86476-1-PBS in a different storage buffer formulation.

NAS1/SLC13A1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86476-1-PBS

Clone No.251252F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

NAS1, SLC13A1, hNaSi-1

---

Product Information

86476-1-PBS targets NAS1/SLC13A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19026

  Product name: Recombinant human SLC13A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 143-249 aa of BC148686

  Sequence: TAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSST

• Full Name: solute carrier family 13 (sodium/sulfate symporters), member 1
• Calculated Molecular Weight: 595 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC148686
• Gene Symbol: NAS1
• Gene ID (NCBI): 6561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BZW2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC13A1 also known as NAS1, is an apical membrane Na(+)-sulfate cotransporter involved in sulfate homeostasis in the kidney. SLC13A1 primarily participates in pH-independent, sodium-dependent cotransport of sulfate across renal proximal tubules and small intestinal epithelia(PMID: 38552027).