NAT10 Monoclonal antibody, PBS Only

• 

  WB analysis using 67465-1-Ig (same clone as 67465-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67465-1-Ig (NAT10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67465-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67465-1-Ig (same clone as 67465-1-PBS)

  WB result of NAT10 antibody (67465-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NAT10 transfected A549 cells. This data was developed using the same antibody clone with 67465-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67465-1-Ig (same clone as 67465-1-PBS)

  WB result of NAT10 antibody (67465-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NAT10 transfected HeLa cells. This data was developed using the same antibody clone with 67465-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NAT10 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67465-1-PBS

Clone No.3E3D8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

18S rRNA cytosine acetyltransferase, 3E3D8, ALP, EC:2.3.1.-, KIAA1709

---

Product Information

67465-1-PBS targets NAT10 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4355

  Product name: Recombinant human NAT10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 676-1025 aa of BC035558

  Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK

• Full Name: N-acetyltransferase 10 (GCN5-related)
• Calculated Molecular Weight: 1025 aa, 116 kDa
• Observed Molecular Weight: 116 kDa
• GenBank Accession Number: BC035558
• Gene Symbol: NAT10
• Gene ID (NCBI): 55226
• RRID: AB_2882694
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H0A0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization.