• Featured Product
  • KD/KO Validated

NAT10 Recombinant monoclonal antibody, PBS Only

NAT10 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA
Cat No. 82585-1-PBS
Clone No.5B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

N acetyltransferase 10, KIAA1709, EC:2.3.1.-, ALP, 5B9

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82585-1-PBS targets NAT10 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4184

Product name: Recombinant human NAT10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 676-1025 aa of BC035558

Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK

Predict reactive species
Full Name N-acetyltransferase 10 (GCN5-related)
Calculated Molecular Weight 1025 aa, 116 kDa
Observed Molecular Weight 116 kDa
GenBank Accession NumberBC035558
Gene Symbol NAT10
Gene ID (NCBI) 55226
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H0A0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. The specificity of this antibody has been tested by siRNA (PMID: 24786082). NAT10 regulates mitotic cell fate by acetylating Eg5. NAT10 depletion results in multinuclear giant cells, which is the hallmark of mitotic catastrophe (PMID: 35210604). NAT10 plays a crucial role in carcinogenesis through influencing EMT, hypoxia, ribosomal biogenesis and overall, promoting translational efficiency. Recently, we reported that treating cancer cells with Remodelin, a small molecule inhibitor of NAT10, causes alteration in global lipid metabolism (PMID: 36149760).

Loading...
||
New chat Able
正在加载,请稍候...