NAT13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NAT13 Polyclonal antibody (16120-1-AP)

NAT13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16120-1-AP Copied!

Publications (1)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MAK3, hSAN, hNAT5, hNaa50p, EC:2.3.1.258

• 

  WB analysis of K-562 using 16120-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16120-1-AP (NAT13 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16120-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16120-1-AP (NAT13 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16120-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16120-1-AP (NAT13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 16120-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16120-1-AP (NAT13 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NAT13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16120-1-AP targets NAT13 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9075

  Product name: Recombinant human NAT13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC012731

  Sequence: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQ

• Full Name: N-acetyltransferase 13 (GCN5-related)
• Calculated Molecular Weight: 169 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC012731
• Gene Symbol: NAT13
• Gene ID (NCBI): 80218
• RRID: AB_2148952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZZ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NAT13 Polyclonal antibody (Cat# 16120-1-AP) has 1 total citation. It appears in Nature Communications (IF 18.1), in a 2026 study on hierarchical small molecule inhibition of MYST acetyltransferases. The research field encompasses epigenetics, histone acetylation, and targeted small-molecule inhibitor development. The antibody was applied in Western blot (WB) using human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Hierarchical small molecule inhibition of MYST acetyltransferases.; Authors - Xuemin Chen

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Both reviewers rate the antibody 5 stars for Western Blot. One used it on HCT116 cell extract at 1:1000 dilution with overnight cold-room incubation on PVDF membrane, describing it as reliable. The other also used a 1:1000 dilution and reported it works well on both PVDF and nitrocellulose membranes. Overall, the antibody is praised for consistent, reliable performance in WB across different membrane types.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Nathalie (Verified Customer) (03-05-2026)

Reliable (overnight cold room incubation, PVDF membrane)

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HCT116 cell extract

Morgane (Verified Customer) (01-28-2026)

Works fine on PVDF and Nitrocellulose

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000

NAT13 Antibody Western Blot validation (1/1000 dilution) in (Cat no:16120-1-AP)