NAT5 Polyclonal antibody

• 

  WB analysis using 15807-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15807-1-AP (NAT5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15807-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15807-1-AP (NAT5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 15807-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 15807-1-AP (NAT5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 15807-1-AP

  IP result of anti-NAT5 (IP:15807-1-AP, 4ug; Detection:15807-1-AP 1:500) with HL-60 cells lysate 3040ug.

• 

  IHC staining of human ovary cancer using 15807-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 15807-1-AP (NAT5 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 15807-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 15807-1-AP (NAT5 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

NAT5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15807-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.3.1.254, Methionine N-acetyltransferase, N acetyltransferase 5, NAA20, N-acetyltransferase 5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HL-60 cells, human brain tissue, HeLa cells, MG-63 cells, U2OS cells
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

15807-1-AP targets NAT5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8541

  Product name: Recombinant human NAT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC005181

  Sequence: MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

• Full Name: N-acetyltransferase 5 (GCN5-related, putative)
• Calculated Molecular Weight: 178 aa, 20 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC005181
• Gene Symbol: NAT5
• Gene ID (NCBI): 51126
• RRID: AB_1640056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61599
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

N-acetyltransferase 5 (NAT5/hNaa50p), also known as NAA20 (N-alpha-acetyltransferase 20), is a catalytic subunit of the N-terminal acetyltransferase B complex, which is a member of the GCN5-related N-acetyltransferase (GNAT) superfamily. It specifically acetylates the N-terminus of proteins (N-terminal acetylation) and is crucial for cell survival, chromosome segregation, and cell cycle progression. Naa20 expression is much higher in HCC tumors than in normal tissues, promoting oncogenic properties in HCC cells. Knockdown of NAA20 significantly inhibited TNBC cell viability by CCK8 and colony formation assays and cell migration and invasion (PMID: 37827343, 33219302).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Mol Sci; NatB Catalytic Subunit Depletion Disrupts DNA Replication Initiation Leading to Senescence in MEFs; Authors - Jasmin Elurbide
human	WB	Oncotarget; NatB-mediated protein N-α-terminal acetylation is a potential therapeutic target in hepatocellular carcinoma.; Authors - Leire Neri
mouse		Mol Cell Biol; NatB Protects Procaspase-8 from UBR4-Mediated Degradation and Is Required for Full Induction of the Extrinsic Apoptosis Pathway; Authors - Joana P Guedes