NAT8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NAT8 Polyclonal antibody (10908-1-AP)

• 

  WB analysis using 10908-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10908-1-AP (NAT8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 10908-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10908-1-AP (NAT8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10908-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10908-1-AP (NAT8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NAT8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10908-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Acetyltransferase 2, ATase2, Camello-like protein 1, CCNAT, CML1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse liver tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10908-1-AP targets NAT8 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1353

  Product name: Recombinant human NAT8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC012626

  Sequence: MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSQ

• Full Name: N-acetyltransferase 8 (GCN5-related, putative)
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC012626
• Gene Symbol: NAT8
• Gene ID (NCBI): 9027
• RRID: AB_2149085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHE5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAT8 (N-acetyltransferase 8), also known as ATase2 or camello-like protein 1, is a microsomal enzyme predominantly expressed in the kidney and liver. It catalyzes the final step in mercapturic acid formation by acetylating cysteine S-conjugates, facilitating the detoxification and excretion of electrophilic xenobiotics. Additionally, NAT8 exhibits protein lysine N-acetyltransferase activity, regulating apoptosis and amyloid-beta secretion through BACE1 acetylation. Genetic variants of NAT8 have been implicated in chronic kidney disease progression and blood pressure regulation. (PMID: 20392701; 18402670)