NAT8L Polyclonal antibody

• 

  WB analysis using 23841-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23841-1-AP (NAT8L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 23841-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using NAT8L antibody (23841-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

NAT8L Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 23841-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

NAA synthetase, Hcml3, EC:2.3.1.17, CML3, Camello-like protein 3

---

Tested Applications

• Positive WB detected in: HUVEC cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

23841-1-AP targets NAT8L in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20832

  Product name: Recombinant human NAT8L protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-134 aa of BC103748

  Sequence: MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE

• Full Name: N-acetyltransferase 8-like (GCN5-related, putative)
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC103748
• Gene Symbol: NAT8L
• Gene ID (NCBI): 339983
• RRID: AB_3669418
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8N9F0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAT8L (N-acetyltransferase 8-like) catalyzes the formation of N-acetyl aspartate (NAA) from acetyl-CoA and aspartate. In the brain, NAA delivers the acetate moiety to synthesize acetyl-CoA, which is further used for fatty acid generation (PMID: 24155240). NAT8L modulation may impinge on the metabolic reprogramming of cancer cells (PMID: 36580805). The calculated MW of NAT8L is around 33 kDa, and the observed MW is around 45 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Naunyn Schmiedebergs Arch Pharmacol; Molecular mechanism of geniposide against ANIT-induced intrahepatic cholestasis by integrative analysis of transcriptomics and metabolomics; Authors - Junyi Zhang