NBEAL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NBEAL1 Polyclonal antibody, PBS Only (25431-1-PBS)

• 

  WB analysis using 25431-1-AP (same clone as 25431-1-PBS)

  HEK-293 cells were subjected to Tris-Acetate gel system followed by western blot with 25431-1-AP (NBEAL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25431-1-PBS in a different storage buffer formulation.

NBEAL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25431-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ALS2CR16, ALS2CR17, neurobeachin like 1, Neurobeachin like protein 1

---

Product Information

25431-1-PBS targets NBEAL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22125

  Product name: Recombinant human NBEAL1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-200 aa of BC137214

  Sequence: MASRERLFELWMLYCTKKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINYVITMTTLYIQQLKSKKKEKEMADQTCIEEFVIHALAFCESLYDPYRNWRHRISGSQIPEGFLRHISIRVSSGKNPATPTPEG

• Full Name: neurobeachin-like 1
• Calculated Molecular Weight: 200 aa, 307 kDa
• Observed Molecular Weight: 280 kDa
• GenBank Accession Number: BC137214
• Gene Symbol: NBEAL1
• Gene ID (NCBI): 65065
• RRID: AB_3742148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZS30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neurobeachin-like 1 (NBEAL1) is a Golgi-associated protein that plays an essential role in cholesterol metabolism regulation.