NBL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NBL1 Polyclonal antibody, PBS Only (12069-1-PBS)

• 

  WB analysis of mouse colon using 12069-1-AP (same clone as 12069-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 12069-1-AP (NBL1 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12069-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12069-1-AP (same clone as 12069-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NBL1 antibody (12069-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12069-1-PBS in a different storage buffer formulation.

NBL1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 12069-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

D1S1733E, DAN, DAND1, NB, Neuroblastoma suppressor of tumorigenicity 1

---

Product Information

12069-1-PBS targets NBL1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2706

  Product name: Recombinant human NBL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-180 aa of BC012037

  Sequence: LALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

• Full Name: neuroblastoma, suppression of tumorigenicity 1
• Calculated Molecular Weight: 180 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC012037
• Gene Symbol: NBL1
• Gene ID (NCBI): 4681
• RRID: AB_10638604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41271
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NBL1 (neuroblastoma suppression of tumorigenicity 1), also named as DAN, is the founding member of the DAN subfamily. It was originally identified as a putative tumor suppressor gene in a transformed fibroblast rat model (PMID: 9516839), whereby it was significantly down-regulated in v-src-transformed rat fibroblasts. The MW of this protein is 19 kDa, and this antibody specially recognises the 19 kDa protein.