NBN / NBS1 Monoclonal antibody, PBS Only

NBN / NBS1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 66980-1-PBS
Clone No.1E11E10

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

AT V1, AT V2, ATV, FLJ10155, NBN, NBS, NBS1, nibrin, P95

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66980-1-PBS targets NBN / NBS1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19320

Product name: Recombinant human NBN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC136803

Sequence: MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDE

Predict reactive species
Full Name nibrin
Calculated Molecular Weight 85 kDa
Observed Molecular Weight 95 kDa
GenBank Accession NumberBC136803
Gene Symbol NBN
Gene ID (NCBI) 4683
RRIDAB_2882300
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60934
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NBN, also named as NBS, NBS1 and P95, is a component of the MRE11/RAD50/NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. NBN also functions in telomere length maintenance by generating the 3' overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. Defects in NBN are the cause of Nijmegen breakage syndrome (NBS). Defects in NBN are a cause of genetic susceptibility to breast cancer (BC). Defects in NBN may be associated with aplastic anemia. Defects in NBN might play a role in the pathogenesis of childhood acute lymphoblastic leukemia (ALL). The antibody is specific to NBN. The full-length NBN protein, with an apparent molecular weight of 95 kDa and the two protein fragments of 26 and 70 kDa arising from the c.657_661del5 (p.K219fsX19) mutation, and the 80 kDa protein found in patient RR with the mutation c.742_743insGG leading to excision of exons 6 and 7 from the NBN mRNA are shown. (PMID: 26265251) The predicted molecular weight of NBN protein (p95) is 85kDa, actually detection result is about 95kDa(PMID: 23762398).

Loading...
||
New chat Able
正在加载,请稍候...