• Featured Product
  • KD/KO Validated

NCAM1/CD56 Recombinant monoclonal antibody

NCAM1/CD56 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 82715-1-RR
Clone No.6N11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

CD56, NCAM1, 6N11, MSK39, N CAM 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, SH-SY5Y cells, U-251 cells, Neuro-2a cells, C6 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue, human tonsillitis tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

82715-1-RR targets NCAM1/CD56 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5528

Product name: Recombinant human NCAM1/CD56 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-352 aa of BC047244

Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE

Predict reactive species
Full Name neural cell adhesion molecule 1
Calculated Molecular Weight 95 kDa
Observed Molecular Weight 120 kDa, 140 kDa, 180 kDa
GenBank Accession NumberBC047244
Gene Symbol NCAM1
Gene ID (NCBI) 4684
ENSEMBL Gene IDENSG00000149294
RRIDAB_3086516
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13591
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isofroms have also been described (PMID: 1856291).

Protocols

Product Specific Protocols
IF protocol for NCAM1/CD56 antibody 82715-1-RRDownload protocol
IHC protocol for NCAM1/CD56 antibody 82715-1-RRDownload protocol
WB protocol for NCAM1/CD56 antibody 82715-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Mol Med

Crosstalk between cancer-associated fibroblasts and non-neuroendocrine tumor cells in small cell lung cancer involves in glycolysis and antigen-presenting features

Authors - Yuanhua Lu
Loading...
||
New chat Able
正在加载,请稍候...