NCAPD3 Polyclonal antibody

• 

  WB analysis of HepG2 using 16828-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16828-1-AP (NCAPD3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16828-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16828-1-AP (NCAPD3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16828-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16828-1-AP (NCAPD3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16828-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16828-1-AP (NCAPD3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16828-1-AP

  IP result of anti-NCAPD3 (IP:16828-1-AP, 4ug; Detection:16828-1-AP 1:500) with HeLa cells lysate 600ug.

• 

  IF Staining of HepG2 using 16828-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 16828-1-AP (NCAPD3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

NCAPD3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 16828-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CAP D3, CAPD3, CNDD3, Condensin 2 complex subunit D3, hCAP D3, hCAP-D3, hcp 6, hHCP 6, KIAA0056, NCAPD3

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

16828-1-AP targets NCAPD3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10429

  Product name: Recombinant human NCAPD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 208-558 aa of BC011408

  Sequence: VLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPPPQPQQWNVRSPARNKDTPACSRRSLRKTPLKTAN

• Full Name: non-SMC condensin II complex, subunit D3
• Calculated Molecular Weight: 1498 aa, 169 kDa
• Observed Molecular Weight: 165 kDa
• GenBank Accession Number: BC011408
• Gene Symbol: NCAPD3
• Gene ID (NCBI): 23310
• RRID: AB_2282528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42695
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4 , but they contain different sets of non-SMC subunits. NCAPD3 is 1 of 3 non-SMC subunits that define condensin II ([PMID: 14532007).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Elife; Molecular dissection of condensin II-mediated chromosome assembly using in vitro assays; Authors - Makoto M Yoshida
	IHC	J Neuroinflammation; Anti-IgLON5 antibodies cause progressive behavioral and neuropathological changes in mice.; Authors - You Ni
bovine	IF	Int J Mol Sci; NCAPG Dynamically Coordinates the Myogenesis of Fetal Bovine Tissue by Adjusting Chromatin Accessibility.; Authors - Xin Hu
human	WB	World J Gastroenterol; Non-SMC condensin I complex subunit D2 and non-SMC condensin II complex subunit D3 induces inflammation via the IKK/NF-κB pathway in ulcerative colitis.; Authors - Chang-Wen Yuan
	WB	Mol Biol Cell; Regulation of condensin II by self-suppression and release mechanisms; Authors - Makoto M Yoshida
human	WB	Front Pharmacol; NCAPD3-mediated ferroptosis of 2,3,5,4'-Tetrahydroxystilbene-2-O-β-D-glucoside inhibits proliferation in T47D cells; Authors - Jianfen Shen