NCAPG Polyclonal antibody

• 

  WB analysis using 29933-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29933-1-AP (NCAPG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 29933-1-AP

  WB result of NCAPG antibody (29933-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NCAPG transfected HEK-293 cells.

• 

  IHC staining of human ovary tumor using 29933-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29933-1-AP (NCAPG antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 29933-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29933-1-AP (NCAPG antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NCAPG Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29933-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CAPG, CHCG, Chromosome-associated protein G, Condensin complex subunit 3, Condensin subunit CAP G

---

Tested Applications

• Positive WB detected in: K-562 cells, HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29933-1-AP targets NCAPG in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32040

  Product name: Recombinant human NCAPG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 870-1015 aa of BC068467

  Sequence: LLNEILEQVKDRTCLRALEKIKIQLEKGNKEFGDQAEAAQDATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS

• Full Name: non-SMC condensin I complex, subunit G
• Calculated Molecular Weight: 1015 aa, 114 kDa
• Observed Molecular Weight: 131 kDa
• GenBank Accession Number: BC068467
• Gene Symbol: NCAPG
• Gene ID (NCBI): 64151
• RRID: AB_2923621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPX3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.