NCAPG2 Polyclonal antibody

• 

  WB analysis using 32220-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32220-1-AP (NCAPG2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

NCAPG2 Polyclonal Antibody for WB, ELISA

Cat No. 32220-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

LUZP5, Leucine zipper protein 5, hCAP-G2, Condensin-2 complex subunit G2, Chromosome-associated protein G2

---

Tested Applications

• Positive WB detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32220-1-AP targets NCAPG2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34991

  Product name: Recombinant human NCAPG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 928-1143 aa of BC043404

  Sequence: ILKEITGSSLIQKTDSDEEVAMLLDTVQKVFQKMLECIARSFRKQPEEGLRLLYSVQRPLHEFITAVQSRHTDTPVHRGVLSTLIAGPVVEISHQLRKVSDVEELTPPEHLSDLPPFSRCLIGIIIKSSNVVRSFLDELKACVASNDIEGIVCLTAAVHIILVINAGKHKSSKVREVAATVHRKLKTFMEITLEEDSIERFLYESSSRTLGELLNS

• Full Name: non-SMC condensin II complex, subunit G2
• Calculated Molecular Weight: 1143 aa, 131 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC043404
• Gene Symbol: NCAPG2
• Gene ID (NCBI): 54892
• RRID: AB_3670224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86XI2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NCAPG2 (non-SMC condensin II complex subunit G2) encodes a protein belonging to the non-SMC (structural maintenance protein) subunit family of the Condensin II complex that plays a key role in chromosome condensation and segregation during mitosis. NCAPG2 is positively correlated with cancer stem cell (CSC) markers, and aberrant NCAPG2 expression contributes to tumorigenesis in several human malignancies, such as prostate cancer and low-grade gliomas.