NCAPG2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87645-1-RR (same clone as 87645-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87645-1-RR (NCAPG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87645-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 87645-1-RR (same clone as 87645-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NCAPG2 antibody (87645-1-RR, Clone: 253099H6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87645-1-PBS in a different storage buffer formulation.

NCAPG2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87645-1-PBS

Clone No.253099H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CAP-G2, Chromosome-associated protein G2, Condensin-2 complex subunit G2, hCAP-G2, Leucine zipper protein 5

---

Product Information

87645-1-PBS targets NCAPG2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34991

  Product name: Recombinant human NCAPG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 928-1143 aa of BC043404

  Sequence: ILKEITGSSLIQKTDSDEEVAMLLDTVQKVFQKMLECIARSFRKQPEEGLRLLYSVQRPLHEFITAVQSRHTDTPVHRGVLSTLIAGPVVEISHQLRKVSDVEELTPPEHLSDLPPFSRCLIGIIIKSSNVVRSFLDELKACVASNDIEGIVCLTAAVHIILVINAGKHKSSKVREVAATVHRKLKTFMEITLEEDSIERFLYESSSRTLGELLNS

• Full Name: non-SMC condensin II complex, subunit G2
• Calculated Molecular Weight: 1143 aa, 131 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC043404
• Gene Symbol: NCAPG2
• Gene ID (NCBI): 54892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86XI2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NCAPG2 (non-SMC condensin II complex subunit G2) encodes a protein belonging to the non-SMC (structural maintenance protein) subunit family of the Condensin II complex that plays a key role in chromosome condensation and segregation during mitosis. NCAPG2 is positively correlated with cancer stem cell (CSC) markers, and aberrant NCAPG2 expression contributes to tumorigenesis in several human malignancies, such as prostate cancer and low-grade gliomas.