NCF4 Polyclonal antibody

• 

  WB analysis of L02 using 15001-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 15001-1-AP (NCF4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 15001-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 15001-1-AP (NCF4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 15001-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15001-1-AP (NCF4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 15001-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15001-1-AP (NCF4 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 15001-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 15001-1-AP (NCF4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 15001-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 15001-1-AP (NCF4 Antibody) at dilution of 1:50 (under 40x lens).

NCF4 Polyclonal Antibody for ELISA

Cat No. 15001-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

NCF, NCF 4, NCF4, Neutrophil cytosol factor 4, p40 phox, P40PHOX, SH3PXD4

---

Product Information

15001-1-AP targets NCF4 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7429

  Product name: Recombinant human NCF4 protein

  Source: e coli.-derived, PET20b

  Tag: 6*His

  Domain: 1-348 aa of BC002798

  Sequence: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAFLPSLRPPPLTSPSHGSLSHSKAPSGSQMSHNAVTSHQRPGWPGQPHSPFPHPTPHFQPDASLLQPVTPLGTSRWRKISAALPY

• Full Name: neutrophil cytosolic factor 4, 40kDa
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC002798
• Gene Symbol: NCF4
• Gene ID (NCBI): 4689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15080
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.