Use Able AI chat for product recommendations

NCKAP5 Polyclonal antibody

NCKAP5 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31199-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

NAP5, Peripheral clock protein, Nck associated protein 5, NAP 5, ERIH2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HepG2 cells
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31199-1-AP targets NCKAP5 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35092

Product name: Recombinant human NCKAP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-115 aa of NM_207363

Sequence: MEGKRQLEKRDFGKRLSLDSSLVEYMDSNKYIEHLLTQLEEQHRSLWREKLAVARLQREVAQRTSEGAMHEKLIHELEEERHLRLQSEKRLQEVTLESERNRIQMRSLQQQFSRM

Predict reactive species
Full Name Nck-associated protein 5
Calculated Molecular Weight209 kDa
Observed Molecular Weight250-260 kDa
GenBank Accession NumberNM_207363
Gene Symbol NAP5
Gene ID (NCBI) 344148
RRIDAB_3669897
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDO14513
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NCKAP5 (Nck-associated protein 5), also known as NAP5. NCKAP5 is predicted to be located in cells, especially in nucleoli, Golgi apparatus, cell membrane and cytoplasm. It is widely expressed in many tissues, especially in lung and kidney, and in more than 20 other tissues. And the expression of NCKAP5 was enhanced in oligodendrocytes, oligodendrocyte precursor cells and astrocytes. It may interact with other protein, such as NPM1 and centromere protein complex, and regulate accurate chromosome segregation and distribution. NCKAP5 may be involved in the formation and development of tumors, especially in the process of tumor variation such as ovary and breast cancer. In addition, NCKAP5 may be a diagnostic biomarker in non-small cell lung cancer (NSCLC), which is related to the infiltration of activated B cells, regulatory T cells (Tregs), neutrophils and dendritic cells (PMID: 36628881). The molecular weight of NCKAP5 is 208 kDa, it also has some protein modifications.

Protocols

Product Specific Protocols
IF protocol for NCKAP5 antibody 31199-1-APDownload protocol
WB protocol for NCKAP5 antibody 31199-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...