Use Able AI chat for product recommendations

NCOA1/SRC-1 Polyclonal antibody, PBS Only

NCOA1/SRC-1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21952-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

NCOA1, SRC 1, bHLHe42, BHLHE74, Class E basic helix-loop-helix protein 74

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

21952-1-PBS targets NCOA1/SRC-1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16603

Product name: Recombinant human NCOA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1122-1441 aa of BC111533

Sequence: RQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE

Predict reactive species
Full Name nuclear receptor coactivator 1
Calculated Molecular Weight 1441 aa, 157 kDa
Observed Molecular Weight 140-160 kDa
GenBank Accession NumberBC111533
Gene Symbol SRC 1/NCOA1
Gene ID (NCBI) 8648
RRIDAB_2935455
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ15788
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nuclear receptor coactivator 1, also named SRC-1, directly binds nuclear receptors and stimulates transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR, and ER), retinoids (RXRs), thyroid hormone (TRs), and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B, and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via the remodeling of chromatin, and possibly act by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3.

Loading...
||
New chat

Able

正在加载,请稍候...