SRC-3/AIB1 Polyclonal antibody

• 

  WB analysis of Raji using 22707-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 22707-1-AP (SRC-3/AIB1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

SRC-3/AIB1 Polyclonal Antibody for WB, ELISA

Cat No. 22707-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ACTR, AIB 1, AIB1, KAT13B, NCoA 3, NCOA3, nuclear receptor coactivator 3, pCIP, RAC 3, RAC3, SRC 3, SRC3, TRAM 1, TRAM1

---

Tested Applications

• Positive WB detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22707-1-AP targets SRC-3/AIB1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18424

  Product name: Recombinant human NCOA3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 255-604 aa of BC119001

  Sequence: TGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVE

• Full Name: nuclear receptor coactivator 3
• Calculated Molecular Weight: 1424 aa, 155 kDa
• Observed Molecular Weight: 155 kDa
• GenBank Accession Number: BC119001
• Gene Symbol: NCOA3
• Gene ID (NCBI): 8202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6Q9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.