NCOA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NCOA5 Polyclonal antibody, PBS Only (20175-1-PBS)

• 

  WB analysis using 20175-1-AP (same clone as 20175-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20175-1-AP (NCOA5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 20175-1-AP (same clone as 20175-1-PBS)

  IP result of anti-NCOA5 (IP:20175-1-AP, 4ug; Detection:20175-1-AP 1:800) with HEK-293 cells lysate 3000ug. This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 20175-1-AP (same clone as 20175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 20175-1-AP (NCOA5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20175-1-AP (same clone as 20175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20175-1-AP (NCOA5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20175-1-AP (same clone as 20175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20175-1-AP (NCOA5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 20175-1-AP (same clone as 20175-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using NCOA5 antibody (20175-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 20175-1-AP (same clone as 20175-1-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug NCOA5 Polyclonal antibody (20175-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 20175-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NCOA5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 20175-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

CIA, Coactivator independent of AF-2, KIAA1637, NCoA-5, Nuclear receptor coactivator 5

---

Product Information

20175-1-PBS targets NCOA5 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14014

  Product name: Recombinant human NCOA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 112-384 aa of BC056872

  Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG

• Full Name: nuclear receptor coactivator 5
• Calculated Molecular Weight: 579 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC056872
• Gene Symbol: NCOA5
• Gene ID (NCBI): 57727
• RRID: AB_10694674
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCD5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nuclear receptor coactivator 5 (NCOA5), also known as coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription as well as the expression of the c-Myc gene (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to the maintenance of the pluripotent stem cell population (PMID: 24268775).