Product Information
15602-1-PBS targets NDFIP1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7985 Product name: Recombinant human NDFIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC004317 Sequence: MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFM Predict reactive species |
| Full Name | Nedd4 family interacting protein 1 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC004317 |
| Gene Symbol | NDFIP1 |
| Gene ID (NCBI) | 80762 |
| RRID | AB_2878157 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BT67 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Ndfip1 is an adaptor protein for the Nedd4 family of ubiquitin ligases and has been found to be upregulated in neurons after brain injury, including head trauma, stroke and metal toxicity. Recent studies confirmed the role of Ndfip1 as a regulator of iron metabolism and pointed out that Ndfip1 was involved in iron homeostasis by regulating the degradation of iron importer divalent metal transporter 1. Ndfip1 is a transmembrane protein that is localized to the Golgi and post-Golgi vesicles such as endosomes. It is an adaptor protein that recruits E3 ligases to ubiquitinate target proteins. It is ubiquitously expressed and contains 2 PY motifs, which interact with several Nedd4 family E3s to degradate proteins.





