Use Able AI chat for product recommendations

NDFIP2 Polyclonal antibody, PBS Only

NDFIP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32043-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Putative MAPK-activating protein PM04/PM05/PM06/PM07, NEDD4 WW domain-binding protein 5A, NEDD4 family-interacting protein 2, Nedd4 Family Interacting Protein 2, N4WBP5A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

32043-1-PBS targets NDFIP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36480

Product name: Recombinant human NDFIP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-220 aa of NM_019080.2

Sequence: MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFS

Predict reactive species
Full Name Nedd4 family interacting protein 2
Calculated Molecular Weight36kDa,336aa
Observed Molecular Weight39 kDa
GenBank Accession NumberNM_019080.2
Gene Symbol NDFIP2
Gene ID (NCBI) 54602
RRIDAB_3742515
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ9NV92
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NDFIP2 (Nedd4 family interacting protein 2) is a gene encoding a membrane-anchored adapter protein involved in a variety of cellular processes. It regulates protein ubiquitination and degradation by binding to the Nedd4 family of E3 ubiquitin ligases.NDFIP2 has a wide intracellular distribution, including the Golgi, mitochondria, and perinuclear region of the cytoplasm. Its function involves negative regulation of gene expression, negative regulation of protein transport, and positive regulation of protein ubiquitination. In addition, NDFIP2 is associated with a variety of diseases, such as supratentorial ventricular meningiomas in children. In the cardiovascular field, NDFIP2 affects cardiac electrophysiologic function by regulating the degradation of hERG potassium channels. It is also involved in the immune response, affecting T cell function by regulating cytokine signaling pathways. In oncology, NDFIP2 has been found to affect the antiviral response by targeting IFITM3.

Loading...
||
New chat

Able

正在加载,请稍候...