NDOR1/NR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDOR1/NR1 Polyclonal antibody (11404-1-AP)

NDOR1/NR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11404-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NDOR1, Novel reductase 1, NADPH-dependent FMN and FAD-containing oxidoreductase, NADPH-dependent diflavin oxidoreductase 1, EC:1.18.1.-

• 

  WB analysis of human spleen using 11404-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11404-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1/NR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 11404-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 11404-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 11404-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 11404-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 11404-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11404-1-AP (NDOR1/NR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 11404-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11404-1-AP (NDOR1/NR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11404-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDOR1/NR1 antibody (11404-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11404-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDOR1/NR1 antibody (11404-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDOR1/NR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HaCaT cells, human liver tissue, human spleen tissue, human lung tissue, mouse thymus tissue, mouse testis tissue, HeLa cells, Jurkat cells, U-251 cells, NIH/3T3 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11404-1-AP targets NDOR1/NR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1909

  Product name: Recombinant human NDOR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-597 aa of BC015735

  Sequence: VLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPREPDVSSPTRLPQPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSSWLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRDQDFYWEAEWQELEKRDCLTLIPAFSREQEQKIYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA

• Full Name: NADPH dependent diflavin oxidoreductase 1
• Calculated Molecular Weight: 606 aa, 68 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC015735
• Gene Symbol: NDOR1
• Gene ID (NCBI): 27158
• RRID: AB_2251225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NDOR1/NR1 polyclonal antibody (Cat# 11404-1-AP) has 9 citations published in journals including Phytotherapy Research, Life Sciences, Toxicology, Experimental Cell Research, Cell Biochemistry and Biophysics, Behavioural Brain Research, Toxicology Research, PLoS One, and Journal of Molecular Neuroscience. The associated research fields span neuropharmacology, depression mechanisms, neurotoxicity, pain modulation, cognitive impairment, and the NMDAR/BDNF signaling pathway.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Phytother Res; Rapid antidepressant-like effect of Fructus Aurantii depends on cAMP-response element binding protein/Brain-derived neurotrophic facto by mediating synaptic transmission.; Authors - Lei Wu
mouse	WB	Life Sci; Geniposide improves depression-like behavior in prenatal stress male offspring through restoring HPA axis- and glucocorticoid receptor-associated dysfunction; Authors - Yu Ma
mouse	WB	Toxicology; PMID: 29800586; Authors - Xiaolong Wang
mouse	WB,IHC	Exp Cell Res; Autophagy promotes membrane trafficking of NR2B to alleviate depression by inhibiting AQP4 expression in mice; Authors - Xu Liu
rat	WB	Cell Biochem Biophys; Geniposide Improves Corticosterone-induced Toxicity in PC12 Cells through the NMDARs and BDNF Pathway; Authors - Qi Ma
mouse	WB	Toxicol Res (Camb); Neurotoxicity, behavioral changes and gene-expression profile of mice exposed to SnS2 nanoflowers.; Authors - Disi Bai