NDOR1/NR1 Polyclonal antibody

• 

  WB analysis of human spleen using 11404-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11404-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1/NR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 11404-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 11404-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11404-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 11404-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11404-1-AP (NDOR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 11404-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11404-1-AP (NDOR1/NR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 11404-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11404-1-AP (NDOR1/NR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11404-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDOR1/NR1 antibody (11404-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 11404-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDOR1/NR1 antibody (11404-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

NDOR1/NR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11404-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NDOR1, Novel reductase 1, NADPH-dependent FMN and FAD-containing oxidoreductase, NADPH-dependent diflavin oxidoreductase 1, EC:1.18.1.-

---

Tested Applications

• Positive WB detected in: HaCaT cells, human liver tissue, human spleen tissue, human lung tissue, mouse thymus tissue, mouse testis tissue, HeLa cells, Jurkat cells, U-251 cells, NIH/3T3 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IHC: See 1 publications below

Product Information

11404-1-AP targets NDOR1/NR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1909

  Product name: Recombinant human NDOR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-597 aa of BC015735

  Sequence: VLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPREPDVSSPTRLPQPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSSWLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRDQDFYWEAEWQELEKRDCLTLIPAFSREQEQKIYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA

• Full Name: NADPH dependent diflavin oxidoreductase 1
• Calculated Molecular Weight: 606 aa, 68 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC015735
• Gene Symbol: NDOR1
• Gene ID (NCBI): 27158
• RRID: AB_2251225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Life Sci; Geniposide improves depression-like behavior in prenatal stress male offspring through restoring HPA axis- and glucocorticoid receptor-associated dysfunction; Authors - Yu Ma
mouse	WB	Phytother Res; Rapid antidepressant-like effect of Fructus Aurantii depends on cAMP-response element binding protein/Brain-derived neurotrophic facto by mediating synaptic transmission.; Authors - Lei Wu
mouse	WB	Toxicology; PMID: 29800586; Authors - Xiaolong Wang
mouse	WB	Behav Brain Res; Down-regulation of NR2B receptors contributes to the analgesic and antianxiety effects of enriched environment mediated by endocannabinoid system in the inflammatory pain mice; Authors - Shukun Jiang
human	WB	J Mol Neurosci; PMID: 28730337; Authors - Xiaolong Wang
mouse	WB	Toxicol Res (Camb); Neurotoxicity, behavioral changes and gene-expression profile of mice exposed to SnS2 nanoflowers.; Authors - Disi Bai