NDP52 Recombinant monoclonal antibody

• 

  WB analysis using 86167-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86167-1-RR (NDP52 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86167-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDP52 antibody (86167-1-RR, Clone: 250714E9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86167-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86167-1-RR against Human NDP52 were performed. The affinity constant is 0.643 nM.

NDP52 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86167-1-RR

Clone No.250714E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CALCOCO2, Calcium-binding and coiled-coil domain-containing protein 2, Nuclear domain 10 protein 52, Nuclear dot protein 52

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, A549 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86167-1-RR targets NDP52 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2866

  Product name: Recombinant human CALCOCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-283 aa of BC015893

  Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE

• Full Name: calcium binding and coiled-coil domain 2
• Calculated Molecular Weight: 446 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC015893
• Gene Symbol: NDP52
• Gene ID (NCBI): 10241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa.